PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa15g003000.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family HD-ZIP
Protein Properties Length: 702aa    MW: 78595.6 Da    PI: 5.2981
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa15g003000.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.13.6e-192579256
                    T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox  2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                    r+ +++t++q++ Le++F ++++p++++r++L ++l+L  +qVk+WFqN+R++ k
  Csa15g003000.1 25 RTGHRHTPQQIQGLEAFFMECPHPDEAQRQQLCEELKLGPDQVKFWFQNKRTQCK 79
                    555789*********************************************9988 PP

2START112.37.5e-362144363206
                     HHHHHHHHHHHHHHC-TT-EEEE.......EXCCTTEEEEEEESSS...SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEEEE CS
           START   3 aeeaaqelvkkalaeepgWvkss.......esengdevlqkfeeskv..dsgealrasgvvdmvlallveellddkeqWdetla....kaetlev 84 
                     a +a +el ++  +ee++Wvkss       +sen+++    +++ ++    +e +++++vv+ ++++l e +ld   +W+e ++    ka+ l v
  Csa15g003000.1 214 AASAVEELKRLFFSEEQFWVKSSidgtdviDSENYEKFSNAVKKFRStsAYVESSKDVTVVPIEATTLIEMFLDAE-KWKELFPtmvnKAKKLHV 307
                     5678889999999*************9999999999876666443335569**********************999.99998888888******* PP

                     ECTT.......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--..-TTSEE-EESSEEEEEEEECTCEEEEEEEE-E CS
           START  85 issg.......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe.sssvvRaellpSgiliepksnghskvtwvehv 170
                     + s        ++l +m  +l  lsplvp R+f++vR++++ ++g w+i+dvS +++ +    ++s   + ++pSg+li++++n  skv w+ehv
  Csa15g003000.1 308 LGSElpirencNILRVMWEQLHILSPLVPpREFMIVRCCQEISKGLWIIADVSHNVDFDFDFvNAS---CYKRPSGCLIQSMPNAQSKVMWIEHV 399
                     ***************************************************997777655433455...5559********************** PP

                     E--SSXX.HHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
           START 171 dlkgrlp.hwllrslvksglaegaktwvatlqrqcek 206
                     ++  +l  h ++r l++ g   gak+w atl+r ce+
  Csa15g003000.1 400 EVAQKLDtHKIYRELLSGGSGYGAKRWIATLERMCER 436
                     ******99***************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.85E-18882IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.8E-191785IPR009057Homeodomain-like
PROSITE profilePS5007115.4992181IPR001356Homeobox domain
SMARTSM003893.3E-182385IPR001356Homeobox domain
CDDcd000865.15E-172482No hitNo description
PfamPF000461.2E-162679IPR001356Homeobox domain
PROSITE profilePS5084840.065203439IPR002913START domain
SuperFamilySSF559612.06E-25205437No hitNo description
CDDcd088754.07E-84208435No hitNo description
SMARTSM002341.1E-15212436IPR002913START domain
Gene3DG3DSA:3.30.530.201.3E-5214395IPR023393START-like domain
PfamPF018525.6E-29214436IPR002913START domain
SuperFamilySSF559615.49E-8457666No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 702 aa     Download sequence    Send to blast
MENDGSGSSW NEQYASEDSK QSGKRTGHRH TPQQIQGLEA FFMECPHPDE AQRQQLCEEL  60
KLGPDQVKFW FQNKRTQCKA QEERAGNLSL RAENEILKNE NEAMFGALSS VLCPDCGGPP  120
FGREEHTLNF QKLLLENVRL KEQRDKIAHL LSNMSKRPTV GDPFASVPTQ HISSYGINPS  180
NMFDPSSSFG PPTSQPIQPQ PISQMDVSLL SETAASAVEE LKRLFFSEEQ FWVKSSIDGT  240
DVIDSENYEK FSNAVKKFRS TSAYVESSKD VTVVPIEATT LIEMFLDAEK WKELFPTMVN  300
KAKKLHVLGS ELPIRENCNI LRVMWEQLHI LSPLVPPREF MIVRCCQEIS KGLWIIADVS  360
HNVDFDFDFV NASCYKRPSG CLIQSMPNAQ SKVMWIEHVE VAQKLDTHKI YRELLSGGSG  420
YGAKRWIATL ERMCERMALT SNLTLPASDW SEVIRTGEER RRVLKLGERM IMNFNEMLTM  480
SGKVDFPQQS KCGVRVSMRM NLEAGQPPGL IVSAASSLRI PLPPVQVFDI LRKLDTRQQW  540
DVLAYGTVVT EIARIATGSS ETNCLSILRP TQEENNNGKM IAQESDKDDM LMLQDCYMDA  600
LGGMLVYAPM DMATMDTTLS GADVKISDIP ILPSGFIISS DGRRSTVEDG GTLLTLAFQI  660
LVSGRTSRSR EVNERSVDTV SALISSTVQR IKGLLNCPDQ F*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010463775.10.0PREDICTED: homeobox-leucine zipper protein HDG8-like isoform X2
SwissprotQ9M9P40.0HDG8_ARATH; Homeobox-leucine zipper protein HDG8
TrEMBLR0HRS60.0R0HRS6_9BRAS; Uncharacterized protein
STRINGAT3G03260.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM127911530
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03260.10.0homeodomain GLABROUS 8